PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF018800030CFD_t1
Common NameTRAES_3BF018800030CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 292aa    MW: 32026.9 Da    PI: 6.7218
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF018800030CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.84.5e-073378245
                             SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                             g+WT eE + + +a +    +   +W+ +a +++ ++t  +++++++
  TRAES3BF018800030CFD_t1 33 GAWTLEENKVFEEALAAIDLDapdRWEMVALMLP-RKTVADVVNHYR 78
                             79*****************99*************.***********8 PP

2Myb_DNA-binding46.49.1e-15140184347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ l++++ k++G g+W+ I+r   + Rt+ q+ s+ qky
  TRAES3BF018800030CFD_t1 140 PWTEEEHRLFLKGLKKYGRGDWRNISRNYVTSRTPTQVASHAQKY 184
                              8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.2842781IPR017877Myb-like domain
SMARTSM007178.2E-63183IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-103387IPR009057Homeodomain-like
CDDcd001674.56E-53480No hitNo description
PROSITE profilePS5129420.286133189IPR017930Myb domain
SuperFamilySSF466891.15E-17135189IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-18136187IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.9E-12137183IPR009057Homeodomain-like
SMARTSM007171.9E-13137187IPR001005SANT/Myb domain
PfamPF002494.6E-12140184IPR001005SANT/Myb domain
CDDcd001674.56E-12140185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MMAEAWVDVL PPPAPYFAGQ PCWAVQQERR GGGAWTLEEN KVFEEALAAI DLDAPDRWEM  60
VALMLPRKTV ADVVNHYRAL ENDVGFIEAG LVPFPHYDSS SPSSGFTLDW DGGAAGAGGF  120
RRGYCLKRGR ADQERKKGVP WTEEEHRLFL KGLKKYGRGD WRNISRNYVT SRTPTQVASH  180
AQKYFIRLTS GGKDNKRRSS IHDITTVNVP DDDDRGSPSG SPPSALTTVD TKPSPSYGGQ  240
RHAFMPPTLP AGTLGGGHPY GNVKLEHQSS FMDGAGLDLD DSLLLQIQCG QL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1429100576RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519240.0JF951924.1 Aegilops speltoides clone TaMYB41 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646487.11e-134PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-75DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLW5CQR30.0W5CQR3_WHEAT; Uncharacterized protein
STRINGMLOC_9835.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.18e-75Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]